A practical reference on certificate of analysis: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-03-21. Anything still debated is marked as such rather than presented as settled.
Detection in biological samples can be complicated by rapid metabolism and low circulating concentrations. Some studies report phase I and phase II metabolites, and analytical methods may need to target those species in addition to the parent compound. Immunoassays are not broadly available, so mass spectrometry remains the main confirmatory approach. For anti-doping testing, laboratories look for SR9009 and its metabolites using validated LC-MS methods. Open questions include how long metabolites remain detectable and how different routes of administration alter detection windows.
In laboratory settings, SR9009 is typically characterized by liquid chromatography–mass spectrometry (LC-MS) or high-performance liquid chromatography with ultraviolet detection (HPLC-UV). These methods can confirm identity and estimate purity, but they require reference standards for accurate quantification. Because SR9009 is not a licensed pharmaceutical, no harmonized pharmacopeial monograph exists. Laboratories often validate in-house methods for matrices such as plasma, urine, or cell culture media. Sample preparation may involve protein precipitation or liquid-liquid extraction before analysis.
Physicochemical behavior influences handling. SR9009 is described as a solid with limited aqueous solubility, so organic solvents such as dimethyl sulfoxide or ethanol are common in research stock solutions. Aqueous dilution can produce precipitates if the organic content is too low. Light, heat, and repeated freeze-thaw cycles may affect stability. Storage recommendations usually specify a desiccated freezer environment protected from light, but exact stability data depend on the formulation and matrix.
Identity and purity testing for SR9009 commonly uses liquid chromatography coupled with tandem mass spectrometry. This method separates the compound from matrix components and detects it by mass-to-charge transitions, providing sensitive and specific confirmation. Nuclear magnetic resonance spectroscopy can support structural identification, while high-performance liquid chromatography with ultraviolet detection may estimate purity. Because online products labeled as SR9009 may contain other substances or no active compound at all, independent verification is important in research settings. Certificates of analysis are useful but not a substitute for in-house testing.
Laboratory samples of SR9009 are typically supplied as a white to off-white powder. The compound dissolves readily in organic solvents such as dimethyl sulfoxide and ethanol, while its solubility in water is low. Because of this solubility profile, researchers often prepare concentrated stock solutions in an organic solvent before diluting them into aqueous assay buffers. Light exposure, moisture, and repeated freeze-thaw cycles can degrade many small molecules, so handling procedures usually aim to minimize these factors. Purity is commonly checked before use.
Storage conditions for research-grade SR9009 generally involve a freezer at approximately minus twenty degrees Celsius, sometimes lower for long-term preservation. Containers should remain tightly closed and protected from light. Desiccants may be used to limit moisture uptake. Solutions are often stored in aliquots to avoid repeated warming and cooling. Stability data for the compound under various conditions are limited, so laboratories typically follow supplier recommendations and verify performance through periodic analytical checks rather than assuming indefinite stability.
| Property | Value | Notes |
|---|---|---|
| Appearance | Off-white to pale yellow solid | Visual description varies with purity and source |
| Solubility | Soluble in DMSO and ethanol; poorly soluble in water | Organic stock solutions are common in research |
| Typical storage | -20 °C, desiccated, protected from light | Avoid repeated freeze-thaw cycles |
| Typical analytical method | LC-MS or HPLC-UV | Reference standards are needed for quantification |
| Molar mass | Approximately 437.9 g/mol | Calculated from the reported free-base formula |
Most published work on SR9009 consists of preclinical studies. It is widely sold as a research chemical, a category that does not imply safety, efficacy, or pharmaceutical-grade quality. Sports anti-doping organizations have listed SR9009 as a prohibited substance, and its presence in an athlete sample can lead to sanctions. Legal status differs by country; in several jurisdictions it is not approved for human consumption and may be treated as an unapproved new drug.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. It is not a steroid, peptide, or natural hormone. In scientific literature, it appears under the code SR9009 and in non-scientific contexts as Stenabolic. The compound was identified through chemical screening efforts aimed at targeting circadian clock components. Its status remains investigational, and no regulatory agency has approved it as a human medicine.
REV-ERB proteins help regulate daily cycles in gene expression, including genes tied to lipid and glucose metabolism. SR9009 binds these receptors and alters their activity in cell and animal experiments. Consequences observed in rodents include changes in skeletal muscle oxidative capacity, blood lipid levels, and exercise performance. The precise chain from receptor occupancy to whole-body effects is still an active area of study. Human responses cannot be assumed from rodent data.
In rodent studies, SR9009 has been reported to increase mitochondrial content in skeletal muscle and improve exercise endurance under some conditions. These findings led to popular descriptions such as an exercise mimetic, although that term oversimplifies the biology. Effects vary by dose, timing, tissue, and model. The compound's influence on circadian pathways means that time of administration can matter in experiments. Whether similar metabolic changes occur in humans remains largely unexplored in controlled published trials.
Pharmacokinetic data for SR9009 are limited in published literature. Some reports indicate low oral bioavailability and rapid clearance in animals, which complicates interpretation of exposure and effect. Researchers often use injected routes in preclinical work to achieve measurable systemic levels. Analytical studies rely on mass spectrometry to detect the parent compound and its metabolites. Questions about tissue distribution, active metabolites, and long-term consequences remain open. Species differences in metabolism can affect observed half-life and target engagement.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. These receptors help regulate circadian rhythms and metabolic gene expression. In laboratory experiments, SR9009 binds these receptors and alters transcription of genes involved in lipid handling, glucose metabolism, and mitochondrial function. It is not a naturally occurring compound and has no approved therapeutic use. Research interest stems from its ability to modify energy metabolism in cells and animal models.
SR9009 is a synthetic small molecule developed as a REV-ERB agonist. It binds to REV-ERBα and REV-ERBβ, nuclear receptors that help regulate circadian rhythms and metabolic gene expression. In cell and animal studies, the compound alters lipid and glucose handling and influences skeletal muscle oxidative capacity. Its exact effects in humans remain largely uncharacterized because controlled clinical trials have not been reported. The molecule is frequently described in preclinical literature as a metabolic modulator.
Research interest in SR9009 grew from studies showing improved running endurance in mice after short treatment periods. Those experiments linked the compound to increased mitochondrial content and fatty acid oxidation in muscle, but the findings come from animal models and specific dosing schedules. Independent replication has been limited, and the pathways connecting REV-ERB activation to exercise performance are still being mapped. Whether similar responses occur in humans is an open question.
SR9009 is supplied as a solid research chemical, often in milligram quantities. Laboratories typically weigh it in a controlled environment because fine powders can disperse. Stock solutions are commonly prepared in dimethyl sulfoxide and stored in small aliquots to reduce freeze-thaw cycles. Personal protective equipment and chemical fume hoods are standard when handling unknown or potent compounds. These practices address laboratory safety rather than human use.
Identity and purity of SR9009 samples are usually checked with chromatographic and spectrometric methods. High-performance liquid chromatography can separate the compound from related impurities, while mass spectrometry provides molecular mass confirmation. Nuclear magnetic resonance spectroscopy may be used for structural verification in research settings. No single method proves biological activity, and certificates of analysis should be reviewed alongside raw data. Independent testing is often needed because online products vary widely.
SR9009 stability depends on temperature, moisture, light, and solvent. Solid material is generally kept cool and dry, while solutions may require protection from repeated warming and cooling. Degradation can appear as color changes, precipitate, or new chromatographic peaks. Researchers should follow supplier instructions and their own stability data. Long-term storage conditions for human use have not been established because the compound lacks approved clinical formulation.
=== 6 April === Fu Cong, China's Ambassador to the European Union, explained in interviews that the recently declared "friendship with no limits" between Russia and China is actually "nothing but rhetoric" and that China will continue to not recognize Crimea as a part of Russia. In another interview, he denied China having any plans to provide Russia with weapons. This was something that U.S. officials have accused China of preparing. He is also reported to have stated that what is most urgent for China is "to stop the fighting to save lives". Ukroboronprom announced that it would launch joint manufacture of 125mm tank rounds for Soviet era tanks with Polska Grupa Zbrojeniowa. Ukroboronprom stated that Poland will be the second NATO country to help Ukraine manufacture Soviet-era shells. Classified documents of US–NATO counter-offensive plan details were leaked from the Pentagon via social media sites. According to experts, the plans have been edited prior to publication to decrease estimates of Russian losses and increase estimates of Ukrainian losses. Some of the experts have questioned the authenticity of the documents and suggested that the leak could be part of a Russian disinformation campaign.
Conventional prenatal tests for chromosomal abnormalities such as Down syndrome rely on analysing the number and appearance of the chromosomes—the karyotype. Molecular diagnostics tests such as microarray comparative genomic hybridisation test a sample of DNA instead, and because of cell-free DNA in plasma, could be less invasive, but as of 2013 it is still an adjunct to the conventional tests.
== Applications and occurrence == Esters are widespread in nature and are widely used in industry. In nature, fats are, in general, triesters derived from glycerol and fatty acids. Esters are responsible for the aroma of many fruits, including apples, durians, pears, bananas, pineapples, and strawberries. Several billion kilograms of polyesters are produced industrially annually, important products being polyethylene terephthalate, acrylate esters, and cellulose acetate.
=== Tetracyclic antidepressants === Mirtazapine has demonstrated anxiolytic effect comparable to SSRIs while rarely causing or exacerbating anxiety. Mirtazapine's anxiety reduction tends to occur significantly faster than SSRIs.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
Sources: en.wikipedia.org
== Chemical properties == It reacts with cesium fluorosulfonate and silver fluorosulfonate to produce the divalent silver compound CsAg(SO3F)3. Iodine(I) fluorosulfonate can be obtained from iodine and peroxydisulfuryl difluoride:
Mexico: Viajero Confiable is a Mexican trusted traveller programme which allows members to pass securely through customs and immigration controls in reduced time, using automated kiosks at participating airports. Viajero Confiable was introduced in three airports in 2014 and has since expanded to additional sites. Like the NEXUS, Global Entry, and TSA PreCheck programs, Viajero Confiable members travelling through participating airports may use designated lanes to clear customs quickly and securely, as the Mexican government has already conducted a background check on them and they are considered trusted travellers. At the participating airports, members may use automated kiosks to scan their passport and fingerprints, and complete an electronic immigration form. The programme is targeted at Mexican citizens, as well as U.S. or Canadian citizens who are members of the Global Entry or NEXUS programme and are lawful permanent residents of Mexico. New Zealand: In New Zealand, a SmartGate system exists at Auckland, Wellington, Christchurch and Queenstown airports, enabling holders of biometric passports issued by New Zealand, Australia, Canada, China, France, Germany, Ireland, the Netherlands, the United Kingdom, and the United States to clear border controls using automated facilities. The system can currently only be used by travellers 12 years of age or older; however, a trial is underway that may lower the age of eligibility to use eGate for people with an eligible ePassport from 12 to 10 years of age.
polymer A macromolecule composed of multiple repeating subunits or monomers; a chain or aggregation of many individual molecules of the same compound or class of compound. The formation of polymers is known as polymerization and generally only occurs when nucleation sites are present and the concentration of monomers is sufficiently high. Many of the major classes of biomolecules are polymers, including nucleic acids and polypeptides.
). This diffusivity leads to a break in the magnetic topology; magnetic field lines can "reconnect" when they collide. Usually, this term is small, and reconnections can be treated as similar to shocks; this process has been shown to be important in Earth-solar magnetic interactions. Extended Extended MHD describes a class of phenomena in plasmas that are higher-order than resistive MHD, but can adequately be treated with a single-fluid description. These include the effects of Hall physics, electron pressure gradients, finite Larmor radii in the particle gyromotion, and electron inertia. Two-fluid Two-fluid MHD describes plasmas that include a non-negligible Hall electric field. As a result, the electron and ion momenta must be treated separately. This description is more closely tied to Maxwell's equations because an evolution equation for the electric field exists. Hall In 1960, M. J. Lighthill criticized the applicability of ideal or resistive MHD theory for plasmas. This concerned the neglect of the "Hall current term" in Ohm's law, a frequent simplification made in magnetic fusion theory. Hall magnetohydrodynamics (HMHD) takes into account this electric-field description of magnetohydrodynamics, and Ohm's law takes the form:
Asp-102, His-57, and Ser-195 form a catalytic triad to specifically hydrolyze a peptide bond where Arg is towards the N terminus and a general amino acid is towards the C terminus. It is believed to follow a similar pathway to other serine-type proteases.
Sources: en.wikipedia.org
It is usually detected by LC-MS or HPLC-UV against a reference standard. In biological matrices, metabolite targeting can improve detection. No universal immunoassay is widely available.
The compound is generally handled as light-sensitive and stored cold and dry. Stability in solution depends on solvent, concentration, and storage time. Specific degradation rates are not fully standardized.
Limited water solubility affects formulation for cell and animal studies. Organic co-solvents are often used to dissolve it. Precipitation can confound assay results if not controlled.
Research-grade SR9009 is typically stored frozen at about minus twenty degrees Celsius, protected from light and moisture. Stock solutions are often kept in aliquots to avoid repeated freeze-thaw cycles. Specific storage conditions should follow the supplier's documentation.