SR9009 raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
Reviewed 2025-12-11. Anything still debated is marked as such rather than presented as settled.
SR9009 is a synthetic small molecule developed as an agonist of the nuclear receptors REV-ERBα (NR1D1) and REV-ERBβ (NR1D2). These receptors help regulate circadian rhythms and metabolic gene expression. In cell and animal studies, SR9009 alters transcription of genes involved in lipid metabolism, inflammation, and mitochondrial function. It is not an approved medicine, and its pharmacological profile in humans remains largely uncharacterized. The compound is frequently discussed in the context of circadian biology and metabolic research rather than clinical use.
Preclinical reports have linked SR9009 to improved endurance and altered energy expenditure in rodents. Such findings have prompted interest in whether REV-ERB activation can influence skeletal muscle metabolism. However, the reported effects depend on dose, route, and experimental model, and replication across laboratories is limited. Human trials have not established comparable outcomes, so claims about exercise performance remain speculative. The absence of controlled human data is a central limitation in interpreting these observations.
SR9009 is a synthetic small molecule developed as a REV-ERB agonist. It binds to REV-ERBα and REV-ERBβ, nuclear receptors that help regulate circadian rhythms and metabolic gene expression. In cell and animal studies, the compound alters lipid and glucose handling and influences skeletal muscle oxidative capacity. Its exact effects in humans remain largely uncharacterized because controlled clinical trials have not been reported. The molecule is frequently described in preclinical literature as a metabolic modulator.
Research interest in SR9009 grew from studies showing improved running endurance in mice after short treatment periods. Those experiments linked the compound to increased mitochondrial content and fatty acid oxidation in muscle, but the findings come from animal models and specific dosing schedules. Independent replication has been limited, and the pathways connecting REV-ERB activation to exercise performance are still being mapped. Whether similar responses occur in humans is an open question.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic REV-ERB agonist | Small molecule; not a steroid or peptide. |
| Primary targets | NR1D1 and NR1D2 | Also known as REV-ERBα and REV-ERBβ. |
| Studied routes | Intraperitoneal in rodents | Oral bioavailability in humans is not established. |
| Human approval | No approved therapeutic indication | No recognized clinical use. |
| Key uncertainty | Human physiological effects | Preclinical findings may not translate. |
Mechanistically, SR9009 binds the ligand-binding domain of REV-ERBα/β and enhances recruitment of corepressor complexes. This represses target genes rather than activating them. Because REV-ERB proteins normally compete with ROR proteins at shared response elements, the net effect depends on tissue and timing. Researchers use SR9009 to probe how nuclear receptor signaling links the clock to metabolism, inflammation, and muscle biology. Findings are largely preclinical, and the precise contribution of each receptor subtype remains under study.
SR9009 is frequently discussed in fitness and research-chemical contexts, yet it has no approved medical indication. Regulatory agencies have not authorized it for human use, and it is not a standard prescription drug. Some sports organizations list it as a prohibited substance because of its potential performance-enhancing properties. Published human data are sparse, so claims about its effects in people often rely on animal models or anecdotal reports. Quality and identity of online materials can vary widely.
Laboratory studies often administer SR9009 by injection because oral absorption appears poor in rodents. Reported pharmacokinetic properties include rapid metabolism and low systemic exposure after oral dosing. Human pharmacokinetic data are sparse, so absorption, distribution, metabolism, and excretion in people are not well defined. Some research explores related REV-ERB compounds with improved drug-like properties. Regulatory approval for any REV-ERB agonist as a human medicine has not been granted to date.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ, also called NR1D1 and NR1D2. These receptors help regulate circadian rhythms and metabolic gene programs. The compound was developed for laboratory research, not as an approved therapeutic. Its identity is distinct from steroid hormones and selective androgen receptor modulators. Scientific interest centers on how REV-ERB activation changes gene expression in cells and animal models.
At the molecular level, SR9009 binds the ligand-binding domain of REV-ERB and strengthens recruitment of corepressor proteins such as NCoR and HDAC3. This increases repression of target genes, including Bmal1 and other clock-controlled and metabolic genes. In rodent studies, such changes have been linked to altered lipid handling, glucose metabolism, and energy expenditure. The precise chain of events between receptor binding and whole-body effects remains an active area of research. Findings in animals do not automatically translate to humans.
The kidney is a vital organ with a variety of responsibilities. It plays an important role in maintaining the water, electrolyte and acid-base balance. It excretes toxic metabolic degradation products such as urea. It also recovers valuable substances such as glucose, amino acids, peptides and minerals initially filtered out of the blood during ultrafiltration in the renal corpuscles. In addition, endogenous and exogenous substances are metabolized and broken down in the kidneys—the kidney is therefore a central metabolic organ alongside the liver. Finally, some hormone-active substances are secreted by the kidney, such as renin, erythropoietin and calcitriol (active form of vitamin D3). As a result, the organ plays an important role in the regulation of blood pressure, new blood formation and the balance of calcium and phosphorus, and is thus crucial to bone metabolism, as well. As carnivores, cats are particularly dependent on the intake of animal proteins because glucose formation from amino acids is their most important energy source. The enzymes of amino acid degradation are adapted to the high protein intake and their activity is largely independent of the protein supply in the diet, so that cats break down endogenous proteins (especially from the muscles) when there is a lack of protein intake (catabolic metabolic state). Meat and offal also contain vital nutrients for the cat, such as Vitamin A, Taurin or arachidonic acid. Compared to a normal human diet, cats consume around six times as much phosphate in their diet with standard cat food.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
=== Post-World War II === Bektashism continued to flourish until the Second World War. After the communists took power in 1945, several babas and dervishes were executed and a gradual constriction of Bektashi influence began. Ultimately, in 1967 all tekkes were shut down when Enver Hoxha banned all religious practice. When the ban was rescinded in 1990, the Bektashism reestablished itself, although there were few left with any real knowledge of the spiritual path. Nevertheless, many tekkes (lodges) operate today in Albania. The most recent head of the order in Albania was Hajji Dedebaba Reshat Bardhi (1935–2011) and the main tekke has been reopened in Tirana. In June 2011, Baba Edmond Brahimaj was chosen as the head of the Bektashi Order by a council of Albanian babas. Today, sympathy for the Order is generally widespread in Albania where approximately 20% to 25% of Muslims self-report as having some connection to Bektashism. Despite the negative effect of Turkey's ban on lodges on Bektashi life, most contemporary Turkish Bektashis have been generally supportive of the country's Kemalist secularism, since Ataturk's reforms have lessened the religious intolerance historically demonstrated towards the community by the Sunni religious establishment during Ottoman times.
Sources: en.wikipedia.org
those with ST segment elevation or new bundle branch block (suspicious for acute injury and a possible candidate for acute reperfusion therapy with thrombolytics or primary PCI), those with ST segment depression or T wave inversion (suspicious for ischemia), and those with a so-called non-diagnostic or normal ECG. A normal ECG does not rule out acute myocardial infarction. Mistakes in interpretation are relatively common, and the failure to identify high risk features has a negative effect on the quality of patient care. It should be determined if a person is at high risk for myocardial infarction before conducting imaging tests to make a diagnosis. People who have a normal ECG and who are able to exercise, for example, do not merit routine imaging. Imaging tests such as stress radionuclide myocardial perfusion imaging or stress echocardiography can confirm a diagnosis when a person's history, physical exam, ECG and cardiac biomarkers suggest the likelihood of a problem.
In the Soviet Union, a Union Republic (Russian: Сою́зная Респу́блика, romanized: Soyúznaya Respúblika) or unofficially a Republic of the USSR was a constituent federated political entity with a system of government called a Soviet republic, which was officially defined in the 1977 constitution as "a sovereign Soviet socialist state which has united with the other Soviet republics to form the Union of Soviet Socialist Republics" and whose sovereignty is limited by membership in the Union. As a result of its status as a sovereign state, the Union Republic de jure had the right to enter into relations with foreign states, conclude treaties with them and exchange diplomatic and consular representatives and participate in the activities of international organizations (including membership in international organizations). The Union Republics were perceived as national-based administrative units of the Union of Soviet Socialist Republics (USSR). The Soviet Union was formed in 1922 by a treaty between the Soviet republics of Byelorussia, Russian SFSR (RSFSR), Transcaucasian Federation, and Ukraine, by which they became its constituent republics of the Union of Soviet Socialist Republics (Soviet Union). For most of its history, the USSR was a one-party state led by the Communist Party of the Soviet Union.
G6PD is generally found as a dimer of two identical monomers (see main thumbnail). Depending on conditions, such as pH, these dimers can themselves dimerize to form tetramers. Each monomer in the complex has a substrate binding site that binds to G6P, and a catalytic coenzyme binding site that binds to NADP+/NADPH using the Rossman fold. For some higher organisms, such as humans, G6PD contains an additional NADP+ binding site, called the NADP+ structural site, that does not seem to participate directly in the reaction catalyzed by G6PD. The evolutionary purpose of the NADP+ structural site is unknown. As for size, each monomer is approximately 500 amino acids long (514 amino acids for humans). Functional and structural conservation between human G6PD and Leuconostoc mesenteroides G6PD points to three widely conserved regions on the enzyme: a nine-residue peptide in the substrate binding site, RIDHYLGKE (residues 198–206 on human G6PD), a nucleotide-binding fingerprint, GxxGDLA (residues 38–44 on human G6PD), and a partially conserved sequence EKPxG near the substrate binding site (residues 170–174 on human G6PD), where we have use "x" to denote a variable amino acid. The crystal structure of G6PD reveals an extensive network of electrostatic interactions and hydrogen bonding involving G6P, three water molecules, three lysine residues, one arginine, two histidines, two glutamic acids, and other polar amino acids. The proline at position 172 is thought to play a crucial role in positioning Lys171 correctly with respect to the substrate, G6P.
=== Awards === 2023 Pulitzer Prize for Fiction, won Note: Hernan Diaz's Trust also won the award. This is the first time two books shared the award in its history. 2023 Orwell Prize for Political Fiction, shortlist 2023 Women's Prize for Fiction, won Note: The first author to win the prize twice; previously won in 2010 for The Lacuna. 2022 James Tait Black Prize for Fiction, won
Sources: en.wikipedia.org
=== Pharmacodynamics === Osavampator is a selective positive allosteric modulator (PAM) of the AMPA receptor. Osavampator and other AMPA PAMs potentiate the effects of agonists at the main site of the AMPA receptor by slowing the rate of desensitization and internalization of the receptor.
21 May The WHO informs about the international 2022 monkeypox outbreak in non-endemic countries – an unprecedented number of cases detected outside of Africa after the first of these cases was detected on 6 May. On 24 May, the WHO states that the outbreak can be contained. The main method used for the early containment is 'ring vaccination' – vaccinating close contacts of positive cases via existing vaccines. 23 May Researchers report that CRISPR-Cas9 gene editing has been used to boost vitamin D in tomatoes. A study shows why decarbonization must be accompanied by strategies to reduce the levels of short-lived climate pollutants with near-term effects for climate goals. 24 May Scientists report the first 3D-printed lab-grown wood. It is unclear if it could ever be used on a commercial scale (e.g. with sufficient production efficiency and quality). A CDC study based on electronic health records shows that "one in five COVID-19 survivors aged 18–64 years and one in four survivors aged ≥65 years experienced at least one incident condition that might be attributable to previous COVID-19" or long COVID. On 18 May, an analysis of private healthcare claims shows that of 78,252 patients diagnosed with 'long COVID', 75.8% had not been hospitalized for COVID-19. 25 May – The world's smallest remote-controlled walking robot, measuring just half a millimetre wide, is demonstrated. Potential applications include the clearing of blocked arteries.
The spot capacity (analogous to peak capacity in HPLC) can be increased by developing the plate with two different solvents, using two-dimensional chromatography. The procedure begins with development of a sample loaded plate with first solvent. After removing it, the plate is rotated 90° and developed with a second solvent.
==== Digital X-ray ==== Eastman Kodak filed the first patent for digital radiography in 1973. The first commercial CR (Computed Radiology) solution was offered by Fujifilm in Japan in 1983 under the device name CR-101. X-ray imaging plates are used in X-ray diagnostics to record the shadow image of X-rays. The first commercial digital X-ray system for use in dentistry was introduced in 1986 by Trophy Radiology (France) under the name Radiovisiography. Digital x-ray systems help reduce radiation exposure. Instead of film, the machines contain a scintillator that converts the incident X-ray photons either into visible light or directly into electrical impulses.
==== mRNA ==== mRNA transcripts from genes expressed in the placenta are detectable in maternal plasma. In this procedure, plasma is centrifuged so an aqueous layer appears. This layer is transferred and from it RNA is extracted. RT-PCR is used to detect a selected expression of RNA. For example, Human placental lactogen (hPL) and beta-hCG mRNA are stable in maternal plasma and can be detected. (Ng et al. 2002). This can help to confirm the presence of cffDNA in maternal plasma.
Sources: en.wikipedia.org
It is a synthetic compound that acts as an agonist at REV-ERBα and REV-ERBβ. It is used mainly as a research chemical to study circadian and metabolic pathways. It is not approved for human therapeutic use.
REV-ERB receptors generally repress transcription when bound by natural heme. SR9009 is described as an agonist that enhances this repressive activity. The result is altered expression of clock and metabolic genes.
Published controlled human trials are lacking. Some sources cite limited or unofficial reports, but these do not establish safety or efficacy. Claims about human performance effects remain unverified.
It is a synthetic REV-ERB agonist used mainly in preclinical research. It is not an approved medicine for human use.